1
0
0
News
Meeting on Enzyme Families in Nucleotide Metabolism
www.bio.net
Claus Lundegaard lundegaard at mermaid.molbio.ku.dk. Tue Apr 8 23:13: ... html -- _Claus Lundegaard Center For Enzyme Research Soelvgade 83 H
Telephone & Addresses
NetTurnP – Neural Network Prediction of Beta-turns by Use of ...ideas.repec.org › plo › pone00
ideas.repec.org
Bent Petersen; Claus Lundegaard; Thomas Nordahl Petersen. Registered: ... Bent Petersen & Claus Lundegaard & Thomas Nordahl Petersen, "NetTurnP ...
Claus Lundegaard - Krak.dk
www.krak.dk
Kontaktinformation for Claus Lundegaard , telefonnummer, adresse og kontaktinformation.
Claus Lundegaard, Søborg | person | krak.dkwww.krak.dk › ... › Søborg
www.krak.dk
Her kan du se gadefoto fra Vadgårdsvej 22B samt omgivelser. På Eniros tjenester i Norden kan du drage nytte af gadefoto fra mere end km veje.
Interests
lastFM: (clundegaard)
Age: 48, male, Denmark
Management & Stakeholders
proff: Claus Lundegaard – 2 roller i dansk erhvervsliv - Proffwww.proff.dk › ... › Segmentering
Proff.dk giver dig rolleinformation om Claus Lundegaard. Se personens roller (2) og relationer (2) i erhvervslivet - og hvilke brancher Claus Lundegaard er aktiv ...
Business Profiles
Researchgate: Claus Lundegaard
Copenhagen, Denmark
patentbuddy: Claus Lundegaard
STRUCTURAL BIOINFORMATICS ADVANCED TECHNOLOGIES A/S, Bagsvaerd, DK
degulesider.dk: Claus Lundegaard | personer | degulesider.dkwww.degulesider.dk › personer
Kontaktinformation for Claus Lundegaard, telefonnummer, adresse og kontaktinformation.
degulesider.dk: Claus Lundsgaard | personer | degulesider.dk | side 1
Claus Lundegaard Vadgårdsvej 22B Søborg. Vis kort og ruteplan · Rejseplan · Ret dine oplysninger Blomster · Hjemmeside · Vingave ...
Private Homepages
Claus Lundegaard's Email & Phone - ALK Abelló - Copenhagen Area,...
contactout.com
Claus Lundegaard's Email. .dk Copenhagen Area, Capital Region, Denmark. Team Leader, Head of Bioinformatics @ ALK Abelló. CEO/CSO @ EIR Sciences....
Employees
Claus Lundegaard
www.cbs.dtu.dk
Claus Lundegaard: Former staff member: Publication list at CBS: This file was last modified Friday 31st 2013f May :38:07 GMT: Follow CBS on Twitter ...
Modelling the human immune system by combining bioinformatics and...
plen.ku.dk
author = "Nicolas Rapin and Can Kesmir and Sune Frankild and Morten Nielsen and Claus Lundegaard and Søren Brunak and Ole Lund",. year = "2006",.
Projects
Project MUSE - Mining the Biomedical Literature
muse.jhu.edu
... Morten Nielsen, Claus Lundegaard, Can KeS ˛mir, and Søren Brunak, Ontologies for Bioinformatics Kenneth Baclawski and Tianhua Niu, ...
Books & Literature
Search New & Used Marketplace Books : Booksamillion.com
www.booksamillion.com
Claus Lundegaard ISBN June Online Price: $
Immunological Bioinformatics (Hardcover, New): Ole Lund, Morten...
www.loot.co.za
Books: Immunological Bioinformatics (Hardcover): Ole Lund, Morten Nielsen, Claus Lundegaard, Can Kesmir, Soren Brunak; Biotechnology; ...
Booktopia Search Results for 'Claus Lundegaard'. We sell books,...
www.booktopia.com.au
Booktopia Bookshop search results for 'Claus Lundegaard'. The items we may sell online for these products are books, paperback, hardback, audio cds or...
bokus.com: Claus Lundegaard - Böcker | Bokus bokhandel
Köp böcker av Claus Lundegaard:
Music
Blue Foundation/In My Mind I Am Free - playlist by Claus Lundegaard |...
open.spotify.com
Listen on Spotify:
Related Documents
CiteSeerX — London, England
citeseerx.ist.psu.edu
@MISC{Nielsen_london,england, author = {Morten Nielsen and Claus Lundegaard and Søren Brunak and Immunological Bioinformatics and A Bradford Book}, title = {London ...
Claus Lundegaard - Academia.edu
independent.academia.edu
Academia.edu is a place to share and follow research.
CiteSeerX
citeseerx.ist.psu.edu
CiteSeerX - Document Details (Isaac Councill, Lee Giles, ... {Claus Lundegaard and Kasper Lamberth and Mikkel Harndahl and Søren Buus and Ole Lund and Morten ...
Immunology | DIS - Danish Institute for Study Abroad
static.disabroad.org
Claus Lundegaard. Ph.D. (Protein Chemistry, Univeristy of Copenhagen, 1998). Ph.D. (Biochemistry, Temple. University School of Medicine, 1996) M.Sc.
Scientific Publications
CPHmodels-3.0—remote homology modeling using structure-guided...
academic.oup.com
Abstract. CPHmodels-3.0 is a web server predicting protein 3D structure by use of single template homology modeling. The server employs a hybrid of the scoring
Reliable prediction of T-cell epitopes using neural networks ...www.ncbi.nlm.nih.gov › pmc › articles › PMC
www.ncbi.nlm.nih.gov
Reliable prediction of T-cell epitopes using neural networks with novel sequence representations. Morten Nielsen, Claus Lundegaard, [...], and Ole Lund.
Publications
- CORE
core.ac.uk
By Claus Lundegaard, Kasper Lamberth, Mikkel Harndahl, Søren Buus, Ole Lund and Morten Nielsen
Publications Authored by Claus Lundegaard | PubFacts
www.pubfacts.com
Publications Authored by Claus Lundegaard
Morten Nielsen . Claus Lundegaard . Ole Lund . mir …
link.springer.com
Immunogenetics (2005) 57: 33–41 DOI s ORIGINAL PAPER Morten Nielsen . Claus Lundegaard . Ole Lund . Can Keşmir The role of the proteasome in generating cytotoxic
BMC Bioinformatics - BioMedSearch
www.biomedsearch.com
Morten Nielsen*, Claus Lundegaard and Ole Lund. Address: Center for Biological Sequence Analysis, BioCentrum-DTU, Technical University ...
Video & Audio
Imitating the immune system - Microsoft Research
www.microsoft.com
Claus Lundegaard. Date 23 March Affiliation. Immunological Bioinformatics, CBS, ... These tools are all linked at http://www.cbs.dtu.dk/services and include a predictor of ...
Reports & Statements
Google Groups: REQ: Frac1.0 3D tetris (very old, ~1990)
: Claus Lundegaard .dk comp sys mac games misc comp sys mac wanted ... I would be very happy, Thanks, Claus -- Claus Lundegaard, Ph.D Center for ...
Google Groups: Unix for Mac???
: Claus Lundegaard Center for Enzyme Research Copenhagen University Institute for Molceular Biology phone: (+45) fax: (+45) e-mail: ...
Google Groups: Meeting on Enzyme Families in Nucleotide Metabolism
: Claus Lundegaard ... bionet announce Please see the new ... Claus Lundegaard Center For Enzyme Research Soelvgade 83 H
Spar benzin med ing.dk - (4): Motor og forvarmning | Ingeniøren
ing.dk
Her kommer kapitel 4. i Motorbloggens serie
Miscellaneous
Claus Lundegaard | LinkedIn
www.linkedin.com
View Claus Lundegaard's professional profile on LinkedIn. LinkedIn is the world's largest business network, helping professionals like Claus Lundegaard discover
Redirecting
www.google.com
Annette Rømmelmayer Larsen og Claus Lundegaard hat auf dieser Seite noch nichts mit dir geteilt.
Claus Lundegaard - Citazioni di Google Scholar
scholar.google.com
Indici citazioni, Tutte, Dal Citazioni, 5517, Indice H, 35, 29. i10-index, 45,
Biological Sequence Analysis Chapter 3 Claus Lundegaard. - ppt...
slideplayer.com
Protein Families Organism 1 Organism 2 Enzym e 1 Enzym e 2 Closely relatedSame Function MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLR...
Claus Lundegaard (born January 17, 1967), Danish educator ...prabook.com › web › claus.lundegaard
prabook.com
Claus Lundegaard, Danish computer scientist, educator. Subscribe. Please subscribe to access the full content. Click for see on larger map. View map. Born.
WO A2 - Sars t cell epitopes and methods for ...www.google.com › patents
patents.google.com
Other languages: English: French; Inventor: Morten Nielsen: Ole Lund: Claus Lundegaard: Peder Worning: Soren Buus: Soren Brunak: Sune Justesen: Christina ...
Stefan Wallin - Google Scholar Citations
scholar.google.se
MedförfattareVisa alla… Hue Sun Chan,; Giorgio Favrin,; Arnab Bhattacherjee,; Alan R. Davidson,; Ugo Bastolla,; YongQi Huang,; Claus Lundegaard,; Morten ...
Claus Lundegaard
www.platekompaniet.no
Medvirkende Claus Lundegaard. Popularitet, Navn A-Å, Navn Å-A, Pris stigende, Pris synkende, Nyeste først, Eldste først. Popularitet. Popularitet; Navn A-Å ...
Claus Lundegaard – bøker | ARK Bokhandelwww.ark.no › forfattere › claus-lund...
www.ark.no
Her finner du bøkene til Claus Lundegaard. Bøkene kjøper du hos ARK – bestill hjemlevering eller klikk og hent i din ARK-butikk.
Internet Archive Search: subject:"Claus Lundegaard"
archive.org
At CBS, we have during the recent years developed a number of web tools to be used in immunological research. These tools are all linked at ...
(PDF) A Community Resource Benchmarking Predictions of Peptide...
www.academia.edu
A Community Resource Benchmarking Predictions of Peptide Binding to MHC-I Molecules
2009 | European Neural Network Society
e-nns.org
The Machine Learning in Immunology competition was won by Claus Lundegaard. The winner received Euro first prize. Congratulations! Two winners of ...
Antibody responses to linear and conformational epitopes - PDF
docplayer.net
E.P. Larsen Morten Nielsen Claus Lundegaard Nick Gauthier. Similar documents © DocPlayer.net Privacy Policy | Terms of Service | Feedback.
Bioinformaticos | Curso sobre avances en inmunología e...
www.bioinformaticos.com.ar
– Rational T cell epitopediscovery, Claus Lundegaard – Complete Analysisof T Cell Epitopes from YellowFever Virus, Søren Buus
NetMHCpan, a Method for Quantitative Predictions of Peptide Binding...
www.scivee.tv
Citation: PLoS ONE Aug 29; 2(8):e796 Authors: Morten Nielsen, Claus Lundegaard, Thomas Blicher, Kasper Lamberth, Mikkel Harndahl, Sune Justesen, Gustav Røder
Reliable B Cell Epitope Predictions: Impacts of Method Development...
journals.plos.org
Claus Lundegaard, Ole Lund, Morten Nielsen x. Published: December 27, 2012; DOI: journal.pcbi ; Article; Authors; Metrics; Comments; Related Content;
Immunome Research|Volume 6, Issue 1 | 2010www.longdom.org › archive › imr-volume-6-issue-1-year...
www.longdom.org
... using a novel concurrent alignment and weight optimization training procedure. Morten Nielsen, Sune Justesen, Ole Lund, Claus Lundegaard, Soren Buus.
Jul Jul 21
World Congress on ...
Vancouver, Canada, Canada
Nov Nov 26
Advancement on Fungal ...
New York, USA, USA
HIV Database: Review articles
www.hiv.lanl.gov
HIV Database: Review articles from the compendia of both the sequence and immunology databases
Related search requests for Claus Lundegaard
| Thomas Nordahl Bent Petersen Thomas Nordahl Petersen | Sune Justesen Søren Buus Olivier Taboureau | Thomas Blicher Pernille Andersen |
People Forename "Claus" (4014) Name "Lundegaard" (39) |
sorted by relevance / date